Protein Info for GFF3612 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Type III secretion inner membrane protein (YscU,SpaS,EscU,HrcU,SsaU, homologous to flagellar export components)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 48 to 64 (17 residues), see Phobius details amino acids 84 to 110 (27 residues), see Phobius details amino acids 142 to 161 (20 residues), see Phobius details amino acids 182 to 183 (2 residues), see Phobius details amino acids 185 to 207 (23 residues), see Phobius details PF01312: Bac_export_2" amino acids 2 to 340 (339 residues), 343.2 bits, see alignment E=8.9e-107 TIGR01404: type III secretion protein, YscU/HrpY family" amino acids 2 to 342 (341 residues), 448.5 bits, see alignment E=8.8e-139

Best Hits

Swiss-Prot: 100% identical to SSAU_SALTY: Secretion system apparatus protein SsaU (ssaU) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03229, type III secretion protein SctU (inferred from 99% identity to sec:SC1443)

Predicted SEED Role

"Type III secretion inner membrane protein (YscU,SpaS,EscU,HrcU,SsaU, homologous to flagellar export components)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (352 amino acids)

>GFF3612 Type III secretion inner membrane protein (YscU,SpaS,EscU,HrcU,SsaU, homologous to flagellar export components) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSEKTEQPTEKKLRDGRKEGQVVKSIEITSLFQLIALYLYFHFFTEKMILILIESITFTL
QLVNKPFSYALTQLSHALIESLTSALLFLGAGVIVATVGSVFLQVGVVIASKAIGFKSEH
INPVSNFKQIFSLHSVVELCKSSLKVIMLSLIFAFFFYYYASTFRALPYCGLACGVLVVS
SLIKWLWVGVMVFYIVVGILDYSFQYYKIRKDLKMSKDDVKQEHKDLEGDPQMKTRRREM
QSEIQSGSLAQSVKQSVAVVRNPTHIAVCLGYHPTDMPIPRVLEKGSDAQANYIVNIAER
NCIPVVENVELARSLFFEVERGDKIPETLFEPVAALLRMVMKIDYAHSTETP