Protein Info for GFF361 in Xanthobacter sp. DMC5

Annotation: Iron uptake protein A2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF01547: SBP_bac_1" amino acids 38 to 286 (249 residues), 60.2 bits, see alignment E=7e-20 PF13531: SBP_bac_11" amino acids 42 to 291 (250 residues), 35.2 bits, see alignment E=2.3e-12 PF13416: SBP_bac_8" amino acids 43 to 300 (258 residues), 50.6 bits, see alignment E=4.8e-17 PF13343: SBP_bac_6" amino acids 75 to 305 (231 residues), 75.1 bits, see alignment E=1.2e-24

Best Hits

Swiss-Prot: 41% identical to IDIA_SYNE7: Iron deficiency-induced protein A (idiA) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: K02012, iron(III) transport system substrate-binding protein (inferred from 88% identity to xau:Xaut_3764)

Predicted SEED Role

"Ferric iron ABC transporter, iron-binding protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (341 amino acids)

>GFF361 Iron uptake protein A2 (Xanthobacter sp. DMC5)
MGRLHLLRSLLAGGALLVAAQGASAQQVVNVYTTREPGLAAPLFEAFTKATGIEVKSVFI
KDGLAERVKAEGASSPADVLMTVDVGNLLDVVDAGITQPVTSPALSAIPANLRDPAGNWY
ALSLRARLVYAAKDEVKLSAITYEDLADPKWKGKICIRSGQHPYNVGLVAAYIVHHGEEK
AEAWLRGLKANLARKPAGGDREGARDILGGICDLAVGNSYYVGLMRSGKGGADQKKWGDG
INVLLPTFQGGGTHVNVSGAAVAKNAPHKDAAVKLLEFAVSPEMQAIYAKQNLEYPVIAA
AEVDPIIGALGPLKVDPIPLVDIAKNRKRASELIDKVGFDN