Protein Info for PS417_18475 in Pseudomonas simiae WCS417

Annotation: Pyrrolidone-carboxylate peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 99% identical to PCP_PSEFL: Pyrrolidone-carboxylate peptidase (pcp) from Pseudomonas fluorescens

KEGG orthology group: K01304, pyroglutamyl-peptidase [EC: 3.4.19.3] (inferred from 87% identity to pfs:PFLU4174)

Predicted SEED Role

"Pyrrolidone-carboxylate peptidase (EC 3.4.19.3)" in subsystem ZZ gjo need homes (EC 3.4.19.3)

MetaCyc Pathways

5-oxo-L-proline metabolism (4/6 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.19.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1UWV9 at UniProt or InterPro

Protein Sequence (213 amino acids)

>PS417_18475 Pyrrolidone-carboxylate peptidase (Pseudomonas simiae WCS417)
MRIVLLTGFEPFDQDPVNPSWEAVRQLDGVQLGSDVKIVARRLPCAFATAGECLSLLIDE
LHPAMVIATGLGPGRSDISVERVAININDARIPDNLGEQPIDTAVVADGPAAFFTTLPIK
AMVKAVREAGIAASVSQTAGTFVCNQVFYLLQHALAGSGVRSGFIHVPFLPEQVAGSQRP
SMALDTMVAGLQAAVLTAWHTPVDVKEAGGQVS