Protein Info for GFF3608 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Type III secretion inner membrane protein (YscQ,homologous to flagellar export components)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 TIGR02551: type III secretion apparatus protein, YscQ/HrcQ family" amino acids 29 to 315 (287 residues), 232.5 bits, see alignment E=5.5e-73 PF06622: SepQ" amino acids 31 to 142 (112 residues), 48.6 bits, see alignment E=1.2e-16 PF28396: SepQ_C" amino acids 162 to 315 (154 residues), 81.2 bits, see alignment E=1.4e-26 PF01052: FliMN_C" amino acids 246 to 315 (70 residues), 55.4 bits, see alignment E=7e-19

Best Hits

Swiss-Prot: 100% identical to SSAQ_SALTY: Secretion system apparatus protein SsaQ (ssaQ) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03225, type III secretion protein SctQ (inferred from 98% identity to sea:SeAg_B1755)

Predicted SEED Role

"Type III secretion inner membrane protein (YscQ,homologous to flagellar export components)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (322 amino acids)

>GFF3608 Type III secretion inner membrane protein (YscQ,homologous to flagellar export components) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MLRIANEERPWVEILPTQGATIGELTLSMQQYPVQQGTLFTINYHNELGRVWIAEQCWQR
WCEGLIGTANRSAIDPELLYGIAEWGLAPLLQASDATLCQNEPPTSCSNLPHQLALHIKW
TVEEHEFHSIIFTWPTGFLRNIVGELSAERQQIYPAPPVVVPVYSGWCQLTLIELESIEI
GMGVRIHCFGDIRLGFFAIQLPGGIYARVLLTEDNTMKFDELVQDIETLLASGSPMSKSD
GTSSVELEQIPQQVLFEVGRASLEIGQLRQLKTGDVLPVGGCFAPEVTIRVNDRIIGQGE
LIACGNEFMVRITRWYLCKNTA