Protein Info for PS417_18460 in Pseudomonas simiae WCS417

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 PF00072: Response_reg" amino acids 3 to 111 (109 residues), 102.6 bits, see alignment E=1.4e-33 TIGR01387: heavy metal response regulator" amino acids 3 to 218 (216 residues), 320.4 bits, see alignment E=2.8e-100 PF00486: Trans_reg_C" amino acids 144 to 219 (76 residues), 87.2 bits, see alignment E=6.2e-29

Best Hits

Swiss-Prot: 62% identical to CZCR_CUPMC: Transcriptional activator protein CzcR (czcR) from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)

KEGG orthology group: K07665, two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR (inferred from 100% identity to pfs:PFLU4171)

Predicted SEED Role

"DNA-binding heavy metal response regulator" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U659 at UniProt or InterPro

Protein Sequence (223 amino acids)

>PS417_18460 transcriptional regulator (Pseudomonas simiae WCS417)
MNILVVEDEPKAGNYLLNGLQELGYSVSLARDGVDGLHQALETPFDVIVLDVMMPKMDGW
EVLRRLRKEADTPVLFLTARDDIADRIKGLELGADDYLIKPFSFAELVARLRTLTRRGPS
RDEEQLQIADLQIDVLKRRVTRAGTRITLTNKEFALLHLFATHQDQVLSRSLIASRVWDM
NFDSDTNVVDVAVRRLRLKIDDPFQLKLIHSVRGIGYRFDTQP