Protein Info for GFF3604 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Type III secretion inner membrane channel protein (LcrD,HrcV,EscV,SsaV)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 681 transmembrane" amino acids 24 to 42 (19 residues), see Phobius details amino acids 48 to 67 (20 residues), see Phobius details amino acids 78 to 99 (22 residues), see Phobius details amino acids 114 to 138 (25 residues), see Phobius details amino acids 207 to 228 (22 residues), see Phobius details amino acids 248 to 269 (22 residues), see Phobius details amino acids 291 to 323 (33 residues), see Phobius details TIGR01399: type III secretion protein, HrcV family" amino acids 21 to 669 (649 residues), 926.9 bits, see alignment E=3.9e-283 PF00771: FHIPEP" amino acids 34 to 660 (627 residues), 670.9 bits, see alignment E=1.1e-205

Best Hits

Swiss-Prot: 100% identical to SSAV_SALDC: Secretion system apparatus protein SsaV (ssaV) from Salmonella dublin (strain CT_02021853)

KEGG orthology group: K03230, type III secretion protein SctV (inferred from 100% identity to see:SNSL254_A1525)

Predicted SEED Role

"Type III secretion inner membrane channel protein (LcrD,HrcV,EscV,SsaV)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (681 amino acids)

>GFF3604 Type III secretion inner membrane channel protein (LcrD,HrcV,EscV,SsaV) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MRSWLGEGVRAQQWLSVCAGRQDMVLATVLLIAIVMMLLPLPTWMVDILITINLMFSVIL
LLIAIYLSDPLDLSVFPSLLLITTLYRLSLTISTSRLVLLQHNAGNIVDAFGKFVVGGNL
TVGLVVFTIITIVQFIVITKGIERVAEVSARFSLDGMPGKQMSIDGDLRAGVIDADHART
LRQHVQQESRFLGAMDGAMKFVKGDTIAGIIVVLVNIIGGIIIAIVQYDMSMSEAVHTYS
VLSIGDGLCGQIPSLLISLSAGIIVTRVPGEKRQNLATELSSQIARQPQSLILTAVVLML
LALIPGFPFITLAFFSALLALPIILIRRKKSVVSANGVEAPEKDSMVPGACPLILRLSPT
LHSADLIRDIDAMRWFLFEDTGVPLPEVNIEVLPEPTEKLTVLLYQEPVFSLSIPAQADY
LLIGADASVVGDSQTLPNGMGQICWLTKDMAHKAQGFGLDVFAGSQRISALLKCVLLRHM
GEFIGVQETRYLMNAMEKNYSELVKELQRQLPINKIAETLQRLVSERVSIRDLRLIFGTL
IDWAPREKDVLMLTEYVRIALRRHILRRLNPEGKPLPILRIGEGIENLVRESIRQTAMGT
YTALSSRHKTQILQLIEQALKQSAKLFIVTSVDTRRFLRKITEATLFDVPILSWQELGEE
SLIQVVESIDLSEEELADNEE