Protein Info for PS417_18445 in Pseudomonas simiae WCS417

Annotation: glycerol-3-phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 PF00702: Hydrolase" amino acids 13 to 180 (168 residues), 76.3 bits, see alignment E=6.6e-25 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 15 to 186 (172 residues), 61.3 bits, see alignment E=1.3e-20 PF13419: HAD_2" amino acids 17 to 187 (171 residues), 61.6 bits, see alignment E=1.7e-20 PF12710: HAD" amino acids 17 to 130 (114 residues), 27.2 bits, see alignment E=7.6e-10

Best Hits

KEGG orthology group: K01112, [EC: 3.1.3.-] (inferred from 92% identity to pfs:PFLU4168)

Predicted SEED Role

"Putative phosphatase YfbT" in subsystem 2-phosphoglycolate salvage

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.-

Use Curated BLAST to search for 3.1.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UNR2 at UniProt or InterPro

Protein Sequence (225 amino acids)

>PS417_18445 glycerol-3-phosphatase (Pseudomonas simiae WCS417)
MSIRGSAVYNRRYRAFLFDMDGTLLNSIAAAERVWSIWAERHGLDVRAFLKTIHGARAID
TITRQALPGVDPEAEARWITEAELNDVEGVVAIPGAVTFLNSLPGDQWALVTSAPRELAL
RRLQAAGIAPPAVLVTAEDVAIGKPNPACYVLGAQRLGVPVQECLVFEDATVGIRAGEAA
EADVMVVTSTHHTPMVTEHPSIDGYEQLNVRRDAQGLLYVQNAAG