Protein Info for GFF3603 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Plasmid conjugative transfer endonuclease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF07894: FAM83" amino acids 29 to 151 (123 residues), 30.8 bits, see alignment E=2.3e-11 PF13091: PLDc_2" amino acids 42 to 167 (126 residues), 96 bits, see alignment E=1.7e-31

Best Hits

KEGG orthology group: None (inferred from 78% identity to rme:Rmet_1890)

Predicted SEED Role

"Plasmid conjugative transfer endonuclease" in subsystem Type 4 conjugative transfer system, IncI1 type

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (176 amino acids)

>GFF3603 Plasmid conjugative transfer endonuclease (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTAFLRSIALAVWLFGMPLLSHAQPSVQVGFSPEGSARQLVLETIGGAQKSIHILAYAFQ
APDIMQALVDAKNRGVEVRVVVDKKRNRNKPSKKAMDFVTSNGVELRTNSHFHIHHDKTI
IVDGHTVQTGSFNFAPSAETMNSENVVVIRGMPEVASQYMAHWASRWKLGKPYPAR