Protein Info for GFF3602 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Type III secretion cytoplasmic protein (YscL)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 transmembrane" amino acids 110 to 126 (17 residues), see Phobius details PF07201: HrpJ" amino acids 46 to 192 (147 residues), 76 bits, see alignment E=2.2e-25 TIGR02511: type III secretion effector delivery regulator, TyeA family" amino acids 255 to 323 (69 residues), 27.6 bits, see alignment E=1.4e-10

Best Hits

Swiss-Prot: 100% identical to SSAL_SALTY: Secretion system apparatus protein SsaL (ssaL) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 98% identity to sek:SSPA1339)

Predicted SEED Role

"Type III secretion cytoplasmic protein (YscL)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (330 amino acids)

>GFF3602 Type III secretion cytoplasmic protein (YscL) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MNIKINEIKMTPPTAFTPGQVIEEQEVISPSMLALQELQETTGAALYETMEEIGMALSGK
LRENYKFTDAEKLERRQQALLRLIKQIQEDNGATLRPLTEENSDPDLQNAYQIIALAMAL
TAGGLSKKKKRDLQSQLDTLTAEEGWELAVFSLLELGEVDTATLSSLKRFMQQAIDNDEM
PLSQWFRRVADWPDRCERVRILLRAVAFELSICIEPSEQSRLAAALVRLRRLLLFLGLEK
ECQREEWICQLPPNTLLPLLLDIICERWLFSDWLLDRLTAIVSSSKMFNRLLQQLDAQFM
LIPDNCFNDEDQREQILETLREVKINQVLF