Protein Info for GFF360 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: ABC-type multidrug transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 transmembrane" amino acids 18 to 39 (22 residues), see Phobius details amino acids 46 to 64 (19 residues), see Phobius details amino acids 76 to 99 (24 residues), see Phobius details amino acids 132 to 153 (22 residues), see Phobius details amino acids 159 to 182 (24 residues), see Phobius details amino acids 189 to 208 (20 residues), see Phobius details amino acids 245 to 266 (22 residues), see Phobius details TIGR01291: ABC-2 type transporter, NodJ family" amino acids 17 to 271 (255 residues), 211.6 bits, see alignment E=7.3e-67 PF01061: ABC2_membrane" amino acids 25 to 236 (212 residues), 68.5 bits, see alignment E=6.3e-23 PF12698: ABC2_membrane_3" amino acids 72 to 264 (193 residues), 43 bits, see alignment E=3.3e-15

Best Hits

Swiss-Prot: 40% identical to NODJ_SINFN: Nodulation protein J (nodJ) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K09694, lipooligosaccharide transport system permease protein (inferred from 86% identity to rfr:Rfer_3557)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (273 amino acids)

>GFF360 ABC-type multidrug transport system, permease component (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSTTHTPSPWSPPRLSMRWWPVFLRNLLVWRKLAIPSLVGNIAEPLMWLVAFGYGMGALV
GQVNLGTPQGSVAVPYILFLASGSICMSAMNAASFEALYSAFSRMHVQKTWDGIMNAPVS
LDDVVLAEMLWAGFKALFTVTAILGVMLALGISHSPKLLLAWPVLLGVGITFSCIALVFN
ALAKGYDFFTYYFTLFLTPMMFLSGVFFPREQLPGVVRQISDWLPLTNAVELVRPLFMDQ
WPTQAWLHASVLLAYTVAAFWLALALTRKRFAK