Protein Info for GFF3599 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: DNA mismatch repair protein MutS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 886 TIGR01070: DNA mismatch repair protein MutS" amino acids 18 to 880 (863 residues), 982.2 bits, see alignment E=1.3e-299 PF01624: MutS_I" amino acids 19 to 131 (113 residues), 142.3 bits, see alignment E=1.8e-45 PF05188: MutS_II" amino acids 140 to 275 (136 residues), 57.9 bits, see alignment E=3.8e-19 PF05192: MutS_III" amino acids 292 to 580 (289 residues), 150.1 bits, see alignment E=2.5e-47 PF05190: MutS_IV" amino acids 450 to 541 (92 residues), 105.5 bits, see alignment E=3.8e-34 PF00488: MutS_V" amino acids 637 to 827 (191 residues), 260.3 bits, see alignment E=2.9e-81

Best Hits

Predicted SEED Role

"DNA mismatch repair protein MutS" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (886 amino acids)

>GFF3599 DNA mismatch repair protein MutS (Hydrogenophaga sp. GW460-11-11-14-LB1)
MKKDFSDSPAAQPDLSQHTPMMQQYLGLKAGHPNTLLFYRMGDFYELFFGDAEKAARLLD
ITLTQRGQSAGQPVIMAGVPFHSVDTYLARLIKLGESVAICEQVGDVATAKGPVERKVVR
VVTPGTLTDSELLSDKSEAVLMAVHPGARTGCGLAWMSVTQGIVFLAQCASDELADWVAR
VSPGEVLYSADATPAFEKSVQALASQSGSNGGRLVAVLRPAWAFDAALGQRKLLEQLQAA
SLAAWDAQDMPDSHAAAAALLNYAEHTQGRALTHVSSLQVARSGERIDLPLNTRRNLELT
QTLRGETSPTLFSLLDVCCTGMGSRALRSWLLEPRRDRAEARARLAAIDTLRGGLWQSLR
QSLKGASDVERITARTALRQVKPRELVGLGQTLERARQLAAQLGPQAAGGLLHGIASHLT
PPDGCAVLLRDALLPEPAALVRDGGVIADGFDAELDELRGIQNHSDAFLIELEQRERTRT
GIANLRVQFNKVHGFYIEVTQGQASKVPDDYRRRQTLKNAERFITPELKAFEDKALSAQD
RALAREKWLYDHLLDELQAYIPPLTQLARAMAALDALCALTERALTLNWCAPQFVPEPCI
DIRGGRHPVVEARLNESSGGSFIANDTVMGPKQRMQVITGPNMGGKSTYMRQVAVIVLLA
SMGSHVPATSCRLGPIDAIHTRIGAADDLANAQSTFMVEMTEAAQILNAATPESLVLMDE
IGRGTSTFDGLALAGGIATHLHDKSRAYTLFATHYFELTEFPASHHAAVNVHVSAVESGG
KGGGGIVFLHQIEPGPASRSYGIQVARLAGVPAGVVQHARHALAALEAQSEESRSQVDLF
APPPATLEPEAHPLQAAVAQIDPDTLSPREALEQLYALKKLASASS