Protein Info for GFF3598 in Xanthobacter sp. DMC5

Annotation: Energy-dependent translational throttle protein EttA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 551 TIGR03719: ATP-binding cassette protein, ChvD family" amino acids 5 to 549 (545 residues), 941.5 bits, see alignment E=1.5e-287 PF00005: ABC_tran" amino acids 24 to 187 (164 residues), 96.7 bits, see alignment E=4.8e-31 amino acids 336 to 469 (134 residues), 92.4 bits, see alignment E=9.6e-30 PF12848: ABC_tran_Xtn" amino acids 226 to 298 (73 residues), 45 bits, see alignment E=2.4e-15 PF05783: DLIC" amino acids 340 to 408 (69 residues), 13.6 bits, see alignment E=6e-06

Best Hits

Swiss-Prot: 59% identical to ETTA_MYCTO: Energy-dependent translational throttle protein EttA (ettA) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 96% identity to xau:Xaut_3474)

Predicted SEED Role

"ABC transporter, ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (551 amino acids)

>GFF3598 Energy-dependent translational throttle protein EttA (Xanthobacter sp. DMC5)
MAPYQYAYHMHGMTKTYAGGKKVLDNVHLSFYPDAKIGVLGNNGAGKSTLLRIMAGIDKD
FTGEARPAEGVRVGYLPQEPALDPTKNVRENVEDGVAKQKAILERYNELAMNYSDETADE
MTRLQDEIEAQGLWDLDSKVEQAMNALGCPPDDWEVTRLSGGERRRVALCRLLLEQPELL
LLDEPTNHLDAETVNWLEGHLRTYPGAILIVTHDRYFLDNVTGWILELDRGRGIPYEGNY
SSWLGQKQKRLQQEGREDEARQRALSREQEWIGASPKARQAKNKARIQRYEELLQRASER
QPSATQIVIPVAERLGQNVIAFDHLSKSFGEKMLIDDLSFKLPPGGIVGVIGPNGAGKTT
LFRMITGQEKPDGGTISIGDSVKLGYVDQSRDALDDKKTVWEEISDGNEVIYVGKKEIPS
RAYCAAFNFKGGDQQKKVGMLSGGERNRVHLAKVLQRGGNVLLLDEPTNDLDVDTLRALE
EALEDYAGCAVIISHDRFFLDRIATHMLAFEGDSHVEWFEGNFADYEEDKKRRLGTDSVI
PKRIQYKKFSR