Protein Info for GFF3597 in Variovorax sp. SCN45

Annotation: TRAP-type C4-dicarboxylate transport system, small permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 signal peptide" amino acids 12 to 19 (8 residues), see Phobius details amino acids 33 to 37 (5 residues), see Phobius details transmembrane" amino acids 20 to 32 (13 residues), see Phobius details amino acids 46 to 68 (23 residues), see Phobius details amino acids 89 to 114 (26 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details PF04290: DctQ" amino acids 26 to 159 (134 residues), 79.3 bits, see alignment E=1.2e-26

Best Hits

KEGG orthology group: None (inferred from 94% identity to vpe:Varpa_5633)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, small permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (209 amino acids)

>GFF3597 TRAP-type C4-dicarboxylate transport system, small permease component (Variovorax sp. SCN45)
MQSFLLAVDRFSTWIGKTFAWCALLLTLLISWEVFSRYALNKPHAWVLDAQIMLYGAMFM
TAGAYTLSKNGHVRGDVLYGFFRPRTQAMVDLTLYIVFFLPGIVALTWAGWIYAGESLAI
REQTFSAEPLPLYPFKYVIPLAGFTLLLQGIVEIIRCVQCIRQGKWPSREQDVEEVDVEK
LKEMVHVKDADIAALDRVVVAQTASEGAR