Protein Info for GFF3593 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Autolysin sensor kinase (EC 2.7.3.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 transmembrane" amino acids 23 to 42 (20 residues), see Phobius details amino acids 48 to 66 (19 residues), see Phobius details amino acids 85 to 107 (23 residues), see Phobius details amino acids 121 to 140 (20 residues), see Phobius details PF06580: His_kinase" amino acids 163 to 246 (84 residues), 67.3 bits, see alignment E=1.1e-22 PF02518: HATPase_c" amino acids 265 to 354 (90 residues), 34.3 bits, see alignment E=2.9e-12

Best Hits

Predicted SEED Role

"Autolysin sensor kinase (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (360 amino acids)

>GFF3593 Autolysin sensor kinase (EC 2.7.3.-) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MAASGMRDTAAMPPFKFKPDVTARRALVVMVVNTVIALMITAVNGDNFAVNLVYSQCIGL
GIWVLIDGGRHVLNPSGWPGAWRMALLVVFAVLTSYLGGSVVANLLLGRPLFASLSNVPR
ATLGFVLMSLAAGGFGAYYFTSRAMLANARLAQEEAQRQASEARLKLLESQLEPHMLFNT
LANLRVLIGTDPVRATAMLDRLNDFLRATLTASRTEANAGRHTLADEFARLRDYLELMAV
RMGPRLRYTLDLPEALAAQPVPPLLLQPLVENSIRHGLEPGLQGGEIRVVARHEGGDLVL
EVSDTGVGCEPSPTPGFGLSQVRERLATAYPGRARMDWQGRPGDGTRALLTLPWQTMPSP