Protein Info for GFF3585 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Secretion system apparatus SsaD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 transmembrane" amino acids 113 to 134 (22 residues), see Phobius details TIGR02500: type III secretion apparatus protein, YscD/HrpQ family" amino acids 8 to 396 (389 residues), 351 bits, see alignment E=4.5e-109 PF16693: Yop-YscD_ppl_1st" amino acids 142 to 201 (60 residues), 68 bits, see alignment E=5e-23 PF21937: Yop-YscD_ppl_2nd" amino acids 203 to 262 (60 residues), 43.6 bits, see alignment E=2.1e-15

Best Hits

KEGG orthology group: K03220, type III secretion protein SctD (inferred from 99% identity to sek:SSPA1356)

Predicted SEED Role

"Secretion system apparatus SsaD" in subsystem CBSS-343509.6.peg.2644

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (399 amino acids)

>GFF3585 Secretion system apparatus SsaD (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MVNPKSSWKIRFLGHVLQGREVWLNEGNLSLGEKGCDICIPLAINEKIILREQADSLFVD
AGKARVRVNGRRFNPNKPLPSSGVLQVAGVAIAFGKQDCELADYQIPVSRSGYWWLAGVF
LIFIGGMGVLLSISGQPETVNDLPLRVKFLLDKSNIHYVRAQWKEDGSLQLSGYCSSSEQ
MQKVRATLESWGVMYRDGVICDDLLVREVQDVLIKMGYPHAEVSSEGPGSVLIHDDIQMD
QQWRKVQPLLADIPGLLHWQISHSHQSQGDDIISAIIENGLVGLVNVTPMRRSFVISGVL
DESHQRILQETLAALKKKDPALSLIYQDIAPSHDESKYLPAPVAGFVQSRHGNYLLLTNK
ERLRVGALLPNGGEIVHLSADVVTIKHYDTLINYPLDFK