Protein Info for GFF3581 in Xanthobacter sp. DMC5

Annotation: Phosphoribosylamine--glycine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00877: phosphoribosylamine--glycine ligase
  • amino acids 1 to 417 (417 residues), 516.1 bits, E=3.5e-159
• PF02844: GARS_N
  • amino acids 1 to 101 (101 residues), 123.2 bits, E=1e-39
• PF01071: GARS_A
  • amino acids 102 to 289 (188 residues), 249.9 bits, E=2.8e-78
• PF02843: GARS_C
  • amino acids 324 to 415 (92 residues), 100.5 bits, E=8.4e-33

Best Hits

Swiss-Prot: 60% identical to PUR2_RHILO: Phosphoribosylamine--glycine ligase (purD) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: K01945, phosphoribosylamine--glycine ligase [EC: 6.3.4.13] (inferred from 87% identity to xau:Xaut_1412)

MetaCyc: 52% identical to phosphoribosylamine--glycine ligase (Escherichia coli K-12 substr. MG1655)
Phosphoribosylamine--glycine ligase. [EC: 6.3.4.13]

Predicted SEED Role

"Phosphoribosylamine--glycine ligase (EC 6.3.4.13)" in subsystem De Novo Purine Biosynthesis (EC 6.3.4.13)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
• superpathway of 5-aminoimidazole ribonucleotide biosynthesis (5/6 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis II (4/5 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.13

Protein Sequence (421 amino acids)

>GFF3581 Phosphoribosylamine--glycine ligase (Xanthobacter sp. DMC5)
MNILLLGSGGREHALAWKLAQSPTIGQFYALPGNPGIAEFADVVEGIPLSAHDTIVKWCQ
EHTIDLVVVGPEAPLVAGLVDRLAAAGILAFGPTAAAARLEGSKLFTKELCKANDIPTAA
FGRFTSTAEAAAYIRGQGAPIVVKADGLMAGKGVVVALTVEEAVDAVEQVFAGGGTEVLI
EEFMEGEEASLFALVDGETVVAFGSAQDHKRAYDGDLGPNTGGMGAYSPAPVLTPELERR
AIEEILIPTARAMAKAGTPYRGVLYAGLMLTTSGPKLVEYNCRFGDPECQVLMPRFAGDL
VEVLHATAAGRLAEVTPQWSPVSAMTVVYASRGYPGPHQIGSPIGGLGEASALEGVTVFQ
AGTRMKGGTLVSNGGRVLNVTATGTTLADARARAYAAIARIDWPDGFFRSDIGWRALGTA
D