Protein Info for GFF3581 in Xanthobacter sp. DMC5

Annotation: Phosphoribosylamine--glycine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 TIGR00877: phosphoribosylamine--glycine ligase" amino acids 1 to 417 (417 residues), 516.1 bits, see alignment E=3.5e-159 PF02844: GARS_N" amino acids 1 to 101 (101 residues), 122.9 bits, see alignment E=1.2e-39 PF01071: GARS_A" amino acids 102 to 289 (188 residues), 249.9 bits, see alignment E=2.8e-78 PF02843: GARS_C" amino acids 324 to 415 (92 residues), 100.8 bits, see alignment E=6.6e-33

Best Hits

Swiss-Prot: 60% identical to PUR2_RHILO: Phosphoribosylamine--glycine ligase (purD) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: K01945, phosphoribosylamine--glycine ligase [EC: 6.3.4.13] (inferred from 87% identity to xau:Xaut_1412)

MetaCyc: 52% identical to phosphoribosylamine--glycine ligase (Escherichia coli K-12 substr. MG1655)
Phosphoribosylamine--glycine ligase. [EC: 6.3.4.13]

Predicted SEED Role

"Phosphoribosylamine--glycine ligase (EC 6.3.4.13)" in subsystem De Novo Purine Biosynthesis (EC 6.3.4.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (421 amino acids)

>GFF3581 Phosphoribosylamine--glycine ligase (Xanthobacter sp. DMC5)
MNILLLGSGGREHALAWKLAQSPTIGQFYALPGNPGIAEFADVVEGIPLSAHDTIVKWCQ
EHTIDLVVVGPEAPLVAGLVDRLAAAGILAFGPTAAAARLEGSKLFTKELCKANDIPTAA
FGRFTSTAEAAAYIRGQGAPIVVKADGLMAGKGVVVALTVEEAVDAVEQVFAGGGTEVLI
EEFMEGEEASLFALVDGETVVAFGSAQDHKRAYDGDLGPNTGGMGAYSPAPVLTPELERR
AIEEILIPTARAMAKAGTPYRGVLYAGLMLTTSGPKLVEYNCRFGDPECQVLMPRFAGDL
VEVLHATAAGRLAEVTPQWSPVSAMTVVYASRGYPGPHQIGSPIGGLGEASALEGVTVFQ
AGTRMKGGTLVSNGGRVLNVTATGTTLADARARAYAAIARIDWPDGFFRSDIGWRALGTA
D