Protein Info for GFF3580 in Pseudomonas sp. DMC3

Annotation: Lipid A export ATP-binding/permease protein MsbA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 586 transmembrane" amino acids 29 to 51 (23 residues), see Phobius details amino acids 67 to 85 (19 residues), see Phobius details amino acids 130 to 150 (21 residues), see Phobius details amino acids 156 to 189 (34 residues), see Phobius details amino acids 256 to 277 (22 residues), see Phobius details PF00664: ABC_membrane" amino acids 31 to 294 (264 residues), 70.2 bits, see alignment E=2.4e-23 PF00005: ABC_tran" amino acids 366 to 510 (145 residues), 105.6 bits, see alignment E=3.3e-34

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 68% identity to pmy:Pmen_2343)

Predicted SEED Role

"Transport ATP-binding protein CydCD" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (586 amino acids)

>GFF3580 Lipid A export ATP-binding/permease protein MsbA (Pseudomonas sp. DMC3)
MNFQRRRDEPLPASAAAFLWRYIRIRPAHFIAMVGLVIGAACCAVVVQYGMKLLVDAMAA
GSAAEQVWHAFGLFMALIVMENLLWRLGGWVGCHTIVGSCADLRVDLFHHLTGHPMRYFR
RHFSGSLANRVSAIGAAADKVYGGLTWRIVPPCVDFIGAVALLLAVHGAMALALVGCVIV
VAALITIFGVRGRSRHIAFASQSARVGGEIVDLVSNVWTIKAFSGRERERLRLEREIGIE
ADSHRSSWMYMEKARVLHDICLTVMAGGMLGWAILLWRAGQVTAGDVVMVSALTFRILHG
SRELALALVETSQQMGVISETLGIVAQPHELSDALEELAPTRGHIKMLDVSYAYPDGRKV
FEHFFLDIPAGQSVGIAGTSGSGKSTLLGLLQRLDDVRSGVILIDDRDIRSVSQDSLRRQ
IAVVPQEPALFNRSILENIGYGQPHATEQQIIDAARQAFCDEFIQALPQGYHTLVGERGV
TLSGGQRQRLGLARAFLKDAPILILDEATSALDSDSEAIIQRALSNLMRGRTVLAVAHRL
STIANFDRVLVLEDGEIVQDGTPEELRESQGRFRTLWQMQAMVHNR