Protein Info for GFF3580 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Transcriptional regulator, MerR family, associated with photolyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 PF13411: MerR_1" amino acids 3 to 70 (68 residues), 61.1 bits, see alignment E=1.8e-20 PF00376: MerR" amino acids 4 to 41 (38 residues), 52 bits, see alignment 9.8e-18 PF22270: MlrA_helical" amino acids 80 to 154 (75 residues), 94.3 bits, see alignment E=7.3e-31 PF22267: MlrA_C" amino acids 161 to 232 (72 residues), 67.8 bits, see alignment E=1.7e-22

Best Hits

Swiss-Prot: 46% identical to MLRA_ECOLI: HTH-type transcriptional regulator MlrA (mlrA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 97% identity to sei:SPC_2339)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (242 amino acids)

>GFF3580 Transcriptional regulator, MerR family, associated with photolyase (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSYSIGEFARLCGINAATLRAWQRRYGLLKPQRTDGGHRLYSDDDIRQALSILDWVRKGV
PISQVKPLLSRPVIRLGDNWITIQETMLQHLHEGRIDALRQLIYDCGREYPRAELVTHLL
RPLRSKVSAHLPAVMTLREILDGIIIAYTSFCLEGDRKAPGNNAFISGWNLSDHCEIWLE
TLTRTGQELRLNVLPSPPVVLAPELFAQRKWFLVTTGKLTAGQKKQLAQWRNVVASLEVI
TL