Protein Info for GFF3578 in Xanthobacter sp. DMC5

Annotation: Allantoinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 TIGR00857: dihydroorotase, multifunctional complex type" amino acids 23 to 425 (403 residues), 322.2 bits, see alignment E=2.5e-100 PF01979: Amidohydro_1" amino acids 54 to 420 (367 residues), 76.5 bits, see alignment E=3.5e-25 PF12890: DHOase" amino acids 54 to 117 (64 residues), 28.4 bits, see alignment E=2e-10 PF07969: Amidohydro_3" amino acids 214 to 389 (176 residues), 32.5 bits, see alignment E=1e-11

Best Hits

KEGG orthology group: K01465, dihydroorotase [EC: 3.5.2.3] (inferred from 92% identity to xau:Xaut_1415)

Predicted SEED Role

"Dihydroorotase (EC 3.5.2.3)" in subsystem De Novo Pyrimidine Synthesis (EC 3.5.2.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.2.3

Use Curated BLAST to search for 3.5.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (446 amino acids)

>GFF3578 Allantoinase (Xanthobacter sp. DMC5)
MPVTFDLLLKGGAVATPAGIAVADIGVTGGRIRAIGDLSAASAGEVVDATGLHILPGVVD
TQVHFREPGLEQKEDLETGSRAAVMGGVTGVFEMPNTIPQTTNPSALEDKIARATARMHC
DFAFYVGGTHDNVKDLPELERLPGAAGIKVFIGSSTGSLLVPDDDGVRNILKVIRRRAAF
HCEDEPRLQERKGLRVPGDASSHPVWRDEIAALTATRRLVNLARETGARVHVLHVTSAEE
MDFLADARDVASVEVTPHHLTMAAPECYERLGTLAQMNPPVREARHRDGLWAAIANGVVD
VLGSDHAPHTLEEKSKPYPESPSGMTGVQTLVPLMLDHVAAGRLTLERFIDLTSAGPARL
FGIAGKGRIVVGYDADFTVVDLKRRATITNGWIASRAQWTPYDGKEVTGWPVGTFVRGRK
VMWEGELTGPSAGQPIRFLETLQPQG