Protein Info for GFF3578 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: COG1683: Uncharacterized conserved protein / FIG143828: Hypothetical protein YbgA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 PF04463: 2-thiour_desulf" amino acids 3 to 123 (121 residues), 100.4 bits, see alignment E=9.8e-33 PF08349: DUF1722" amino acids 166 to 283 (118 residues), 134.8 bits, see alignment E=1.7e-43

Best Hits

KEGG orthology group: None (inferred from 99% identity to seg:SG1727)

Predicted SEED Role

"COG1683: Uncharacterized conserved protein / FIG143828: Hypothetical protein YbgA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (293 amino acids)

>GFF3578 COG1683: Uncharacterized conserved protein / FIG143828: Hypothetical protein YbgA (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MDFVMNSLAPWVAYKPICPEVAIGLPVPRPALRLIQTTCGDIRMRYSHAPHDDVTERMNA
FADRFLPTIGELAGFIVCAKSPSCGMERVRLYDEKGNRGRKAGTGLFTAAMMDKYPWLPI
EEDGRLHDPVLRENFIARIFALHELNALRAQGLSRHSLLAFHSRYKLQLLAHHQAGYREI
GPFVARLHEWDDLDAFFVRYREKLMAILRHPASRKNHTNVLMHIQGYFHRALNSRQRAEL
REVILGYRAGRLPILAPLTLLKHYLAEHPDDYLRSQNYFEPYPDTLGLRLAIT