Protein Info for GFF3576 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: FIG074102: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 PF03942: DTW" amino acids 41 to 234 (194 residues), 188.1 bits, see alignment E=7.4e-60

Best Hits

Swiss-Prot: 45% identical to YFIP_ECOLI: DTW domain-containing protein YfiP (yfiP) from Escherichia coli (strain K12)

KEGG orthology group: K05812, conserved hypothetical protein (inferred from 66% identity to pau:PA14_17650)

MetaCyc: 45% identical to tRNA 3-amino-3-carboxypropyltransferase (Escherichia coli K-12 substr. MG1655)
tRNA-uridine aminocarboxypropyltransferase. [EC: 2.5.1.25]

Predicted SEED Role

"FIG074102: hypothetical protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (259 amino acids)

>GFF3576 FIG074102: hypothetical protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTFVPPLAPPPVPGHAVSRLRTARLAVSAKPFVARGSGSGRCAGCRLTASHCLCAWRPQT
PTRAGVCLVMGDIEALKPSNTGWLVADVVADTWAFGWSRTEVDPGLLALLADPQWQPYLV
FPGEFAPPERVVTDLTPPAVGQAPVADRKPLFVLLDGTWSEARKMFRKSPYLDHLPVLSL
EPEQVVSNYRLRRSSRESHFCTSEVAALCLALAGERHAAETLAAWLDVFTAHYLSIKRGL
PLDLASEAHLRLLALRAVD