Protein Info for GFF3575 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Tetrathionate reductase sensory transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 592 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 305 to 328 (24 residues), see Phobius details PF12974: Phosphonate-bd" amino acids 29 to 259 (231 residues), 120.4 bits, see alignment E=1.7e-38 PF00512: HisKA" amino acids 358 to 418 (61 residues), 27.8 bits, see alignment E=4.2e-10 PF02518: HATPase_c" amino acids 477 to 577 (101 residues), 67.3 bits, see alignment E=3.1e-22 PF13589: HATPase_c_3" amino acids 478 to 538 (61 residues), 28.2 bits, see alignment E=3.5e-10

Best Hits

Swiss-Prot: 100% identical to TTRS_SALTY: Tetrathionate sensor histidine kinase TtrS (ttrS) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K13040, two-component system, LuxR family, sensor histidine kinase TtrS [EC: 2.7.13.3] (inferred from 99% identity to stt:t1254)

Predicted SEED Role

"Tetrathionate reductase sensory transduction histidine kinase" in subsystem Tetrathionate respiration

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (592 amino acids)

>GFF3575 Tetrathionate reductase sensory transduction histidine kinase (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VRGKTVRRLAVLAAVGLLCHGAWAGTWNIGILAMRGEASTRSHWQPLAKTLSQQLPGETF
HIQPLDLHQMQEAVNQGTVQFVITNPAQFVQLNSHAPLRWLASLRSTRDGKAVSNVIGSV
ILTRRDSGITTAHDLIGKTVGAIDAQAFGGYLLGYKALSDAGLRPERDFHLRFTGFPGDA
LVYMLREKAVQAAIVPVCLLENMDQEGLINKKDFIALLSRPTPLPCLTSTPLYPDWSFAA
LPAVSDALADRVTRALFNAPAAASFHWGAPASTSQVEALLRDVRQHPQQRRLWLDVKSWL
IQHQLMVGGVILAFLLLTLNYIWVMLLVRRRGKQLERNSVVLHQHERALETARQMSVLGE
MTSGFAHELNQPLSAIRHYAQGCLIRLRAADEQHPLLPALEQIDQQAQRGADTLRNLRHW
VSQAQGNPVLTEAWKAIAIREAIDHVWQLLRMAQQFPTVTLHTEVSAALRVTLPSVLLEQ
VLANIILNAAQAGATHLWIVAERTENGISIVLQDNAGGIDEALLRQAFQPFMTTRKEGMG
LGLAICQRLVRYGRGDISIRNQTAPDGLSGTVVTIHFLHENGGRDGDNSSTG