Protein Info for GFF3573 in Variovorax sp. SCN45

Annotation: Efflux ABC transporter, ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 27 to 171 (145 residues), 115.4 bits, E=3.3e-37
• PF13304: AAA_21
  • amino acids 140 to 200 (61 residues), 34.6 bits, E=2e-12

Best Hits

Swiss-Prot: 61% identical to NODI_PARXL: Nod factor export ATP-binding protein I (nodI) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K09695, lipooligosaccharide transport system ATP-binding protein (inferred from 96% identity to vpe:Varpa_5647)

Predicted SEED Role

"ABC, transporter, ATP-binding protein"

Protein Sequence (314 amino acids)

>GFF3573 Efflux ABC transporter, ATP-binding protein (Variovorax sp. SCN45)
VPPTTAPTPPLFHVSRLRKRYGETTVVDDLSFEIAPGECLGVIGPNGAGKTTTIRMCLGL
TAPDGGEISALGLQMPRDALAIKAQLGVVSQFDTLDPDFSCAENLVVYGRYFGFGKAQVR
ARVPQLLEFAALSHKADAKPGELSGGMRRRLSLARALVNDPKLLLLDEPTTGLDPQARHL
MWERLQVLLQQGKSILLTTHFMDEAERLCSRLLVLDHGRKIAEGRPRDLIAEHLEPDVVE
VYGNGALSLAESAELKAMAARVEVSGETVFFYTQDARRLLEALTRHGGLRTFHRPANLED
LFLKLTGRQIREDG