Protein Info for GFF3568 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Amino acid transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 38 to 59 (22 residues), see Phobius details amino acids 71 to 114 (44 residues), see Phobius details amino acids 119 to 137 (19 residues), see Phobius details amino acids 147 to 167 (21 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details amino acids 226 to 248 (23 residues), see Phobius details amino acids 279 to 306 (28 residues), see Phobius details amino acids 328 to 347 (20 residues), see Phobius details amino acids 356 to 378 (23 residues), see Phobius details amino acids 386 to 403 (18 residues), see Phobius details amino acids 409 to 428 (20 residues), see Phobius details PF13520: AA_permease_2" amino acids 15 to 409 (395 residues), 120.4 bits, see alignment E=9.6e-39 PF00324: AA_permease" amino acids 26 to 414 (389 residues), 98.2 bits, see alignment E=4.7e-32

Best Hits

KEGG orthology group: None (inferred from 99% identity to stt:t1247)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (447 amino acids)

>GFF3568 Amino acid transporter (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKKVKKLSLTDLVLYGLVFMVPIAPVSLYGVVYNLSHGMVALVYIIGAIAMFFTAYSYST
LSQHISSSGSAYAYAGVCINPAVGFLTGWILLLDYLLFPTLVAVLGGVAVHAILPQIPVW
VWPLIYVAIGTGVNYLGIQQTAKFDKLLVFIQLGILAIFVLLIVRLMLLDSSQITLSFRP
FFDSQWFTPGLIATAISVAALNFLGFDAISTLSEESEGGGRAVSKATLLALVLATVLFII
VVAFAAFATGNVDRFAEGNATNEAFFTIAGNVGGIWLKVAFSIIVAFVCAVGNIITAQTA
VSRVLFSMGRDRMLPAFLAHVHTTRKTPDYAILFTGGVTLLLSYLFSGKIESISTLVNFG
ALFAFFVVNLCVFILFNFRMKAQRRIFAHVISPIMGMIVIGYVCLNMNIHALILGISWAA
IGIAILCYRKAHNQNIAIDLEGKKLLD