Protein Info for GFF3561 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 619 transmembrane" amino acids 24 to 40 (17 residues), see Phobius details amino acids 46 to 64 (19 residues), see Phobius details amino acids 73 to 95 (23 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details amino acids 243 to 263 (21 residues), see Phobius details amino acids 269 to 297 (29 residues), see Phobius details amino acids 305 to 325 (21 residues), see Phobius details amino acids 345 to 370 (26 residues), see Phobius details PF01594: AI-2E_transport" amino acids 27 to 369 (343 residues), 152.8 bits, see alignment E=8e-49

Best Hits

KEGG orthology group: None (inferred from 68% identity to xau:Xaut_1431)

Predicted SEED Role

"transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (619 amino acids)

>GFF3561 hypothetical protein (Xanthobacter sp. DMC5)
MLQSQDPSLPGPAAGVDLPGRDRLLAFFTAIAIVTVLYVGRDVFVPIAVAILLSFVLAPV
ILVLRRVRVPRTAAAVVVVIATFVGLLALGSVIALQTSDLVAELPKYRFNLSEKIRSVKE
ATGGSGTFERTMDMIQDLGRELEAPDPAKAVKEEGGPFATGGRPLPVEIRQPPPGTLGTL
STVMAPLLHPLATIGIIFIFVLFILLQREDLRNRFVRLAGAHDMQRTTAALDDAARRLSR
FFLTQVALNAAFGTVIGVGLWLIGVPSPLLFGIAAAVLRFVPYVGAAVAAALPIGFALAV
DPGWTMVLSAFALFIVVEPLVGHVIEPLLYGRSTGLSPVAVIAAATFWTWLWGPIGLLLS
TPLTLCLVVLGRHVESLEFLDVALGDRPPLSDSELLYQRLLAGDPIEAAASAEDVLRQTD
LDAYCDGVVLPALKLAQRDAARGALDAERQVRIRDTLADLLEHLPAPEEKIAADGEDAED
TGPRPEGPSVLVLPARSALDEAAAQLLVYRLIADGVAAEAAAPGGARRLATGQAGMVVLA
YLSPATPAHRRYTIRTLSRDRTGRRVVVADFMAEGPPPVLQGEAAAVSTVKGAVEAAQME
APASEPAAPAVVPVRAGAA