Protein Info for GFF3561 in Variovorax sp. SCN45

Annotation: Glycosyltransferases involved in cell wall biogenesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 transmembrane" amino acids 262 to 283 (22 residues), see Phobius details amino acids 299 to 319 (21 residues), see Phobius details PF00535: Glycos_transf_2" amino acids 31 to 186 (156 residues), 34.5 bits, see alignment E=1.9e-12

Best Hits

KEGG orthology group: None (inferred from 92% identity to vpe:Varpa_5658)

Predicted SEED Role

"Glucosyl-3-phosphoglycerate synthase (EC 2.4.1.266)" (EC 2.4.1.266)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.266

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (342 amino acids)

>GFF3561 Glycosyltransferases involved in cell wall biogenesis (Variovorax sp. SCN45)
MMPDQVAARCALVLETNNLRGGADAEARAGASLQRLVALLARQKLPLAALAQVVITHDGL
SPATCDAVSALAGRPVDFVRIDAATGYYDAKNVGFAATDAQRCTHVVFADADCLPDDDWL
LQMLLPFTQGADAPAVVAGRTSYAANVVGTALTTIDFMYFPNADHAGATSNFYANNVAFR
REVFEQHSYQALDGVYRAHCQVLGMRLKAAGVPIHYAAAAHTEHRLPDTRMEALKLRWMR
GQDTYSLTPHLLRSYVSPRWQWLAKSGPIGPLCVLFTRLGFSIKALNRQDLPPLRGPRWL
SGVALILGFSAVDMLGAFARGIGWHTTGRTNADAQALSYHRP