Protein Info for GFF356 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 TIGR02963: xanthine dehydrogenase, small subunit" amino acids 3 to 458 (456 residues), 475.5 bits, see alignment E=8.1e-147 PF00111: Fer2" amino acids 7 to 55 (49 residues), 23.9 bits, see alignment 6.7e-09 PF01799: Fer2_2" amino acids 82 to 157 (76 residues), 96.7 bits, see alignment E=1.4e-31 PF00941: FAD_binding_5" amino acids 188 to 350 (163 residues), 145.4 bits, see alignment E=3.1e-46 PF03450: CO_deh_flav_C" amino acids 359 to 457 (99 residues), 85.7 bits, see alignment E=4.5e-28

Best Hits

KEGG orthology group: K13481, xanthine dehydrogenase small subunit [EC: 1.17.1.4] (inferred from 74% identity to xau:Xaut_3759)

Predicted SEED Role

"Xanthine dehydrogenase, iron-sulfur cluster and FAD-binding subunit A (1.17.1.4)" in subsystem Purine Utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.17.1.4

Use Curated BLAST to search for 1.17.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (471 amino acids)

>GFF356 hypothetical protein (Xanthobacter sp. DMC5)
VAIAFVLNGERIEVADAAPSMTVLDFLRTRRRLTGAKEGCAEGDCGACTIAIGSQQGGAA
RWQVANSCILLLSQIDGSEVKTVEGLAGPSGLHTVQTVLAESDGTQCGFCTPGVVMSLYA
LAQERAGEAPVSDADIHEALAGNLCRCTGYRPIVDAARALCAAPPVAEPESVPPVAGTRI
AGQGELHLVPHTLAELVALRSAYPDAVLIAGATDLGLIPAKKRQGFPLAISTRRVTELKR
MGWEGDQLVLGAAVTYADGLETVEAAFPAFGALIRRIGSRQIRTMGTFGGNLGTASPVGD
TLPVLLALDAEVELAGPAGVRRMKVADFLTGYRQTALARDEVIAALRLPRLAEGEALFAW
KLSRRFDQDISTLLGAFRVRVDGGQMTAFAAAFGGMADRAKRAPALEALLTGAPWADAPP
EGIEAALDADFAPLSDHRASAAYRQAAAANLVRRLHLTTTRPGVPLELEAL