Protein Info for PS417_18165 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 139 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 40 to 60 (21 residues), see Phobius details amino acids 84 to 109 (26 residues), see Phobius details amino acids 114 to 133 (20 residues), see Phobius details PF20398: DUF6691" amino acids 2 to 137 (136 residues), 173.5 bits, see alignment E=1.6e-55

Best Hits

Swiss-Prot: 50% identical to Y1893_XYLFT: UPF0394 membrane protein PD_1893 (PD_1893) from Xylella fastidiosa (strain Temecula1 / ATCC 700964)

KEGG orthology group: K07112, (no description) (inferred from 77% identity to ppw:PputW619_3142)

Predicted SEED Role

"GENE II AND X PROTEINS"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UC47 at UniProt or InterPro

Protein Sequence (139 amino acids)

>PS417_18165 membrane protein (Pseudomonas simiae WCS417)
MIKVTAFIAGLLFGLGLLLAGMANPTKVLAFLDIAGAWDPSLALVMIGAIAVAIGPLTWA
RRHSRSLLGAPMQLPAKRGLDRRLVGGSLLFGIGWGIAGVCPGPAVAILLTGQWQVILFT
VAMLGGMLLFTVLENRRRG