Protein Info for GFF3546 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Crotonobetainyl-CoA dehydrogenase (EC 1.3.99.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 PF02771: Acyl-CoA_dh_N" amino acids 6 to 108 (103 residues), 67.3 bits, see alignment E=3e-22 PF02770: Acyl-CoA_dh_M" amino acids 121 to 216 (96 residues), 82.8 bits, see alignment E=3.3e-27 PF00441: Acyl-CoA_dh_1" amino acids 228 to 376 (149 residues), 159.5 bits, see alignment E=1.3e-50 PF08028: Acyl-CoA_dh_2" amino acids 244 to 356 (113 residues), 63.5 bits, see alignment E=5.4e-21

Best Hits

Swiss-Prot: 95% identical to YDIO_ECO57: Probable acyl-CoA dehydrogenase YdiO (ydiO) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to sei:SPC_2374)

MetaCyc: 32% identical to short-chain acyl-CoA dehydrogenase monomer (Homo sapiens)
BUTYRYL-COA-DEHYDROGENASE-RXN [EC: 1.3.8.1]; 1.3.8.1 [EC: 1.3.8.1]

Predicted SEED Role

"Crotonobetainyl-CoA dehydrogenase (EC 1.3.99.-)" (EC 1.3.99.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.-

Use Curated BLAST to search for 1.3.8.1 or 1.3.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (383 amino acids)

>GFF3546 Crotonobetainyl-CoA dehydrogenase (EC 1.3.99.-) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MDFSLTEEQELLLASIRELITSNFPEEYFRTCDQTGTYPKEFMQALAENGISMLGVPEEF
GGIPADYVTQMLALMEISKCGAPAFLITNGQCIHSMRRFGSAEQLRKTAESTLATGDPAY
ALALTEPGAGSDNNSATTTWTRKNGKVYLNGQKTFITGAKEYPYMLVLARDTEPKDPKKA
FTLWWVDSNKPGIKINPLHKIGWHMLSTCEVYLDNVEVDESDRVGEEGMGFLNVMYNFEM
ERLINAARSTGFAECAFEDAARYANQRIAFGKPIGHNQMIQEKLALMAIKIENMRNMVLK
VAWQADREESLRTSAALAKLYCARTAMEVIDDAIQIMGGLGYTDEARVSRFWRDVRCERI
GGGTDEIMIYVAGRQILKDYQNK