Protein Info for PS417_18155 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 788 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR03303: outer membrane protein assembly complex, YaeT protein" amino acids 24 to 788 (765 residues), 855 bits, see alignment E=2.7e-261 PF07244: POTRA" amino acids 93 to 172 (80 residues), 51.8 bits, see alignment E=2.2e-17 amino acids 176 to 263 (88 residues), 59.9 bits, see alignment E=6.7e-20 amino acids 266 to 344 (79 residues), 56 bits, see alignment E=1.1e-18 amino acids 348 to 420 (73 residues), 54.9 bits, see alignment E=2.4e-18 PF01103: Omp85" amino acids 448 to 788 (341 residues), 315.4 bits, see alignment E=1.2e-97

Best Hits

KEGG orthology group: K07277, outer membrane protein (inferred from 98% identity to pfs:PFLU4104)

Predicted SEED Role

"Outer membrane protein assembly factor YaeT precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U605 at UniProt or InterPro

Protein Sequence (788 amino acids)

>PS417_18155 membrane protein (Pseudomonas simiae WCS417)
MNFSRLLCSVALLLNASLALAQGFKISDIRINGLQRVSAGSVFGALPLNVGDEADDRRLV
DSTRALFKTGYFQDIQLSREGDVLIINVVERPSVASIEFEGNKAIATDDLMKGMKQSGLS
ESEIFQRATLEGLRNELQRQYVAQGRYSASVDTEVVPQPRNRVGLKIKIDEGEVASIQHI
NVVGNTVFADAALLDQFTLKTSNWLSFFRNDDKYAREKLSGDLERLRSFYLDRGYINMDI
ASTQVSMTPDKKHVYITVNIQEGQKYTVRDVKLSGELKVPQDQVQALLLVKKGQVFSRKL
MTTTSDLITRRLGNDGYTFANVSGTPQVHEADHTVDITFSVEPGKRAYVNRINFRGNTKT
DDKVLRREMRQMEGGWASTYLIDQSKVRLERLGYFKEVNVETPAVTGLDDQLDVNYAVQE
QASGSITASVGFAQSSGLILGGSITQNNFLGTGNSASLGLTRSSYQSKYNIGFTDPYFTR
DGVSLGYNAFYNKTDYNKYYDDGVSYYAINSYGLGASLGYPINETSRLSFGLTAQHDSIE
PGTYSADEIYDFIEREGKQFTNFKANLGWSESTLNKGVLATRGHAQNLNLTVTVPGSDLS
FYKIDYTGQTFLPVSNNTALRLHTKLGYGNGYGSTDGLPFYESYTAGGEGTVRGFESGTL
GPRSTPATGTYASAGQAYYSDRDTEALGGNILITGGAEYLFPVPFIKDNKSVRTSLFWDV
GSVYSDKCYLSTTQGCGGVDLSQMASSVGVGVTWYSPLGPLSVNLAYPIRTPENADKQVF
QFSMGQTF