Protein Info for GFF3544 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Electron transfer flavoprotein, beta subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01012: ETF
  • amino acids 28 to 205 (178 residues), 114.7 bits, E=2.3e-37

Best Hits

Swiss-Prot: 80% identical to YDIQ_ECOLI: Putative electron transfer flavoprotein subunit YdiQ (ydiQ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to see:SNSL254_A1466)

Predicted SEED Role

"Electron transfer flavoprotein, beta subunit" in subsystem Acetyl-CoA fermentation to Butyrate

Protein Sequence (254 amino acids)

>GFF3544 Electron transfer flavoprotein, beta subunit (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKIITCFKLVPEEQDITVTPEHSLNFDRAEAKISQFDLNAIEAAAQLAGGGDEIAALTVG
GSLLQNSKVRKDVLSRGPDALFMVQDAQMEHALPKETALALASAAEKIGFDLLLFGEGSG
DIYAQQVGLLTGELLKLPVINAVSHIQRDGDKIIVERTLEEDVEIIELTLPAVLCVTSDI
NVPRIPSMKAILGAGKKAVTSWLASDIHWTPTTPMAELVAISVPPQTERKHIILDNDSPE
AITALADHLKKSLN