Protein Info for GFF3543 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Electron transfer flavoprotein, alpha subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01012: ETF
  • amino acids 19 to 163 (145 residues), 62.7 bits, E=4.2e-21
• PF00766: ETF_alpha
  • amino acids 189 to 268 (80 residues), 94.2 bits, E=3.8e-31

Best Hits

Swiss-Prot: 73% identical to YDIR_ECOLI: Putative electron transfer flavoprotein subunit YdiR (ydiR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to sea:SeAg_B1819)

Predicted SEED Role

"Electron transfer flavoprotein, alpha subunit" in subsystem Acetyl-CoA fermentation to Butyrate

Protein Sequence (311 amino acids)

>GFF3543 Electron transfer flavoprotein, alpha subunit (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MNHLANVWVFSDNVERYAELMTGARQWGEKVYAIVQGNTDIDYVKALGADEIVILESHTD
LQRVENYAETLASLLGDQNGLLLMAATKRCKALGARLSIQLDAVMVNDATSIDLLDGTLH
AEHRMYGGLAFGKEKLNSPQAIITLAPGVLEPAAPLPGHTCPQTTLAYIAPRHEVLCQQR
RAKSLSSVDLSKAKRVIGVGRGLAAQSDLDMVHKLATVLGAEVGCSRPIAEGENWMERER
YIGVSGVLLKSDLYLTLGISGQIQHMVGGNGAKIIVAINKDKNAPIFNYADYGLVGDIYK
VVPALIDQLSR