Protein Info for GFF3542 in Pseudomonas sp. DMC3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 37 to 58 (22 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 94 to 116 (23 residues), see Phobius details amino acids 125 to 143 (19 residues), see Phobius details amino acids 152 to 173 (22 residues), see Phobius details amino acids 183 to 200 (18 residues), see Phobius details amino acids 212 to 233 (22 residues), see Phobius details amino acids 240 to 261 (22 residues), see Phobius details amino acids 267 to 286 (20 residues), see Phobius details PF00892: EamA" amino acids 13 to 139 (127 residues), 36 bits, see alignment E=4e-13 amino acids 154 to 281 (128 residues), 65.4 bits, see alignment E=3.3e-22

Best Hits

KEGG orthology group: None (inferred from 92% identity to pfo:Pfl01_2490)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>GFF3542 hypothetical protein (Pseudomonas sp. DMC3)
MDNAIRRGSLEMTAAMLISGTIGWFVLVSGQPVLDVVFWRCVFGAGTLLLVCAAFGFLRP
GMLTRTTFLLAVLSGMAIVGNWLLLFASYSRASIAIGTAVYNVQPFMLVGLAALFLGEKI
TLQKLFWLAISFMGMLAIVSAHGTQGEEGNDYLMGIALALGAAFLYAIAALIIKRLTGTP
PHLIALIQVCTGVLLLAPFAHFDALPQGVDAWASLLTLGIVHTGLMYVLLYGAIQKLPTA
LTGALSFIYPIAAIFVDWFAFGHRLELLQWIGVAAILLAAAGMQQGWGWKARRLAAQ