Protein Info for GFF3542 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Probable electron transfer flavoprotein-quinone oxidoreductase FixC (EC 1.5.5.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 signal peptide" amino acids 6 to 25 (20 residues), see Phobius details PF01946: Thi4" amino acids 6 to 53 (48 residues), 29.1 bits, see alignment 2.9e-10 PF01494: FAD_binding_3" amino acids 6 to 172 (167 residues), 45.2 bits, see alignment E=3.9e-15 PF01266: DAO" amino acids 7 to 53 (47 residues), 32.5 bits, see alignment 3.4e-11 amino acids 108 to 328 (221 residues), 37.1 bits, see alignment E=1.4e-12 PF00890: FAD_binding_2" amino acids 7 to 42 (36 residues), 26.8 bits, see alignment 1.6e-09 PF12831: FAD_oxidored" amino acids 7 to 155 (149 residues), 36.2 bits, see alignment E=2.3e-12 PF03486: HI0933_like" amino acids 7 to 48 (42 residues), 26.1 bits, see alignment 1.9e-09 PF13450: NAD_binding_8" amino acids 10 to 41 (32 residues), 31.3 bits, see alignment (E = 1e-10) PF21162: ETFQO_UQ-bd" amino acids 180 to 279 (100 residues), 35.8 bits, see alignment E=5e-12

Best Hits

Swiss-Prot: 80% identical to YDIS_ECOLI: Probable electron transfer flavoprotein-quinone oxidoreductase YdiS (ydiS) from Escherichia coli (strain K12)

KEGG orthology group: K00313, electron transfer flavoprotein-quinone oxidoreductase [EC: 1.5.5.-] (inferred from 99% identity to spq:SPAB_01982)

Predicted SEED Role

"Probable electron transfer flavoprotein-quinone oxidoreductase FixC (EC 1.5.5.-)" in subsystem Acetyl-CoA fermentation to Butyrate (EC 1.5.5.-)

Isozymes

Compare fitness of predicted isozymes for: 1.5.5.-

Use Curated BLAST to search for 1.5.5.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (428 amino acids)

>GFF3542 Probable electron transfer flavoprotein-quinone oxidoreductase FixC (EC 1.5.5.-) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSDDKFDAIVVGAGVAGTVAAYVMAKAGLDVLVIERGNSAGSKNMTGGRLYAHSIESIMP
GFATSAPIERVVTREKISFLTEESAVTLDFHRAPPTPPLTSYTVLRNKLDPWLMAQAEQA
GAQFIPGVRVDALVREGNRVTGVQAGDDILDANIVILADGVNSMLGRSLDMVPVSSAHHY
AVGVKELIGLSPALIEERFNLASHEGAAWLFAGAPSNGLMGGGFLYTNRDSVSLGLVCGL
GDIAHATKSVPQMLEDFKQHPAIRPLIQGGTLLEYSAHMVPEGGIAMMPELANDGVMIVG
DAAGLCLNLGYTVRGMDLAIASAQAAAQTAIDAKARQDFSAASLAGYKRALEKNGVLRDM
RHFRKLPGLMENPRLFTEYPRMAANIVGDLFTVDGGPVPPLRKTILSHAKKIGLVNLLKD
GIKGATAL