Protein Info for GFF3536 in Variovorax sp. SCN45

Annotation: Alcohol dehydrogenase (EC 1.1.1.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 PF08240: ADH_N" amino acids 31 to 133 (103 residues), 63.5 bits, see alignment E=3e-21 PF00107: ADH_zinc_N" amino acids 174 to 298 (125 residues), 92.6 bits, see alignment E=3e-30 PF13602: ADH_zinc_N_2" amino acids 206 to 334 (129 residues), 50.8 bits, see alignment E=5.2e-17

Best Hits

KEGG orthology group: None (inferred from 87% identity to vpe:Varpa_5673)

Predicted SEED Role

"Alcohol dehydrogenase (EC 1.1.1.1)" in subsystem Fermentations: Mixed acid or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.1

Use Curated BLAST to search for 1.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (336 amino acids)

>GFF3536 Alcohol dehydrogenase (EC 1.1.1.1) (Variovorax sp. SCN45)
MQETRTLRRWQLPKLGRANLEQAEAPLPAPGANQILVRVGAVALNYRDLLMVRDGMGMPL
ALPFTPGSDMAGTVVAAGEGVTRFASGDRVLGTFWGGWIDSHWQAGATLLGGPGPGMLAS
HVCIDADWAVTAPATLSLAEASTLPCAGLTAWFALAETGGLRAGETVLIHGTGGVALFGL
QIARLHGARAIVVTGSEDKRQQALALGASHVLARSSDWPAEVRRLTHGRGADHVLELASG
PNLDRSLQALRQGGRVSIIGMLEGETLSASFYAMVLGRATVQGIGVGHRRALEDLVRAVD
VNALKPVIAARYAFDALPDALDHLARGPFGKIVVTL