Protein Info for GFF3536 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 528 transmembrane" amino acids 169 to 189 (21 residues), see Phobius details amino acids 196 to 216 (21 residues), see Phobius details PF13426: PAS_9" amino acids 17 to 109 (93 residues), 46.7 bits, see alignment E=1.2e-15 PF08448: PAS_4" amino acids 19 to 112 (94 residues), 37.5 bits, see alignment E=8.8e-13 PF00989: PAS" amino acids 21 to 112 (92 residues), 48.5 bits, see alignment E=2.9e-16 TIGR00229: PAS domain S-box protein" amino acids 23 to 114 (92 residues), 49 bits, see alignment E=3.1e-17 PF08447: PAS_3" amino acids 31 to 114 (84 residues), 61.6 bits, see alignment E=2.5e-20 PF00672: HAMP" amino acids 216 to 261 (46 residues), 31.5 bits, see alignment 6.3e-11 PF18947: HAMP_2" amino acids 219 to 265 (47 residues), 26.5 bits, see alignment 1.8e-09 PF00015: MCPsignal" amino acids 331 to 486 (156 residues), 174.6 bits, see alignment E=6e-55

Best Hits

KEGG orthology group: K03776, aerotaxis receptor (inferred from 50% identity to bpt:Bpet0639)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (528 amino acids)

>GFF3536 Methyl-accepting chemotaxis protein I (serine chemoreceptor protein) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MRNNLPVTHNEFVIPEGVTLVSTTDLQSRITYCNPAFVAVSGFERDELLGQPHNIVRHPD
MPAEAFRDMWATLASGSPWSALVKNRRKNGDHYWVEANATPVLENGQTVGYMSVRTAPTR
DQVKQAEALYARMRGEQGEGRVALSLRQGRVVQSGTIGRLRDMARLTLGKRVALCSVGMA
AAGLVTGELAAPYGAAAHVGAGAALLAVASAAALLLRQQMLTPLQRAVAFANQMAAGDLS
ARFQGHANGEFGELTKALNQLNVNLQAVVADVRHEVEGVQVASSQIAAGNQDLSSRTESQ
ASSLEQTAASVEELSSTVQQSANASREASVLSQRSASVAREGNDAMARVIHTMDDISRSS
NRIGEIIGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRSLAQRTMTASKEIK
ALIDESTGQVAAGSELVHSTGKTMTEVVQSVEQVNGLIADITHATQEQALGLGQINQAVG
QLDSVTQQNSAMVEQLAAAAGSLQAQAQVMNDAVRVFRLQQRAVVARA