Protein Info for GFF3535 in Variovorax sp. SCN45

Annotation: Aquaporin Z

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 39 to 59 (21 residues), see Phobius details amino acids 85 to 107 (23 residues), see Phobius details amino acids 132 to 153 (22 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 208 to 228 (21 residues), see Phobius details PF00230: MIP" amino acids 7 to 225 (219 residues), 162.7 bits, see alignment E=5.9e-52 TIGR00861: MIP family channel proteins" amino acids 11 to 225 (215 residues), 184.3 bits, see alignment E=1.5e-58

Best Hits

Swiss-Prot: 71% identical to AQPZ_CHRVO: Aquaporin Z (aqpZ) from Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)

KEGG orthology group: K06188, aquaporin Z (inferred from 92% identity to vap:Vapar_4980)

MetaCyc: 66% identical to water channel AqpZ (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-145

Predicted SEED Role

"Aquaporin Z"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (235 amino acids)

>GFF3535 Aquaporin Z (Variovorax sp. SCN45)
MEHSTGKKWAAEFIGTFWLTLGGCGSAVLAAAFPGTGIGFHGVALAFGLTVVTGAYALGP
ISGGHFNPAVSIGLAAAGRFRASQLAGYIVAQVLGAIAAAGVLYLIATGKPGADIGGFAT
NGYGEHSPGKYGMTAALITEVVMTAVFLIVILGATAKRAAGGFAGLAIGLCLTLIHLVSI
PVTNTSVNPARSTGPALFGPSYAVSELWLFWVAPIAGAIVGAVIYRALLSSSNDD