Protein Info for GFF3534 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Selenoprotein O and cysteine-containing homologs

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 480 PF02696: SelO" amino acids 2 to 452 (451 residues), 494.2 bits, see alignment E=2e-152

Best Hits

Swiss-Prot: 100% identical to SELO_SALTY: Protein adenylyltransferase SelO (selO) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K08997, hypothetical protein (inferred from 100% identity to stm:STM1345)

MetaCyc: 82% identical to protein adenylyltransferase SelO (Escherichia coli K-12 substr. MG1655)
RXN0-7371 [EC: 2.7.7.108]

Predicted SEED Role

"Selenoprotein O and cysteine-containing homologs"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.108

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (480 amino acids)

>GFF3534 Selenoprotein O and cysteine-containing homologs (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MTLSFTARWRDELPATYTALLPTPLKNARLIWYNDELAQQLAIPASLFDATNGAGVWGGE
TLLPGMSPVAQVYSGHQFGVWAGQLGDGRGILLGEQLLADGSTLDWHLKGAGLTPYSRMG
DGRAVLRSTIRESLASEAMHYLGIPTTRALSIVTSDTPVQRETQETGAMLMRLAQSHMRF
GHFEHFYYRREPEKVQQLADFAIRHYWPQWQDVPEKYALWFEEVAARTGRLIAEWQTVGF
AHGVMNTDNMSILGLTIDYGPFGFLDDYDPGFIGNHSDHQGRYRFDNQPSVALWNLQRLA
QTLTPFIEIDALNRALDRYQDALLTHYGQRMRQKLGFFTEQKDDNVLLNELFSLMAREGS
DYTRTFRMLSHTEQQSASSPLRDTFIDRAAFDAWFDRYRARLRTEAVDDALRQQQMQRVN
PAIVLRNWLAQRAIDAAEQGDMAELHRLHEVLRQPFTDRDDDYARRPPEWGKRLEVSCSS