Protein Info for GFF3533 in Variovorax sp. SCN45

Annotation: Two-component system sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 transmembrane" amino acids 21 to 47 (27 residues), see Phobius details amino acids 163 to 184 (22 residues), see Phobius details PF26769: HAMP_PhoQ" amino acids 189 to 233 (45 residues), 29.1 bits, see alignment 1.2e-10 PF00512: HisKA" amino acids 239 to 302 (64 residues), 50.9 bits, see alignment E=2e-17 PF02518: HATPase_c" amino acids 352 to 456 (105 residues), 79.8 bits, see alignment E=3.2e-26

Best Hits

KEGG orthology group: K07645, two-component system, OmpR family, sensor histidine kinase QseC [EC: 2.7.13.3] (inferred from 84% identity to vpe:Varpa_5676)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (466 amino acids)

>GFF3533 Two-component system sensor histidine kinase (Variovorax sp. SCN45)
MTGGDRSSGRWWRPHSLRTQLLLWLITLHLGAAVLTAWFSFVAYGNLVHNAMDDQMRLVA
DSYGGSDPLKIPRPMDGEAAFSRGVFIVQIWSPDGHTLRASSWPVLAVPLQSRAGFSDVS
TGAHAQSSWRVFTAEPGPRADQPRVQVLQNEDYRRRRALRRALLEGLPITLLLPLALLIL
WIIVSAASRSLRAVARDVASQDERSPTELSLARVPEEIAPLVGAFNNLLSRVRSAFATQR
RFVQDAAHELRTPMAAIGLQIENLRAHVPAGEATERFNQLEAGVTRAQHLIEQLLNLSRQ
DAPQRSTAGECVDIEVLLRESVSQLMVVADARRVDIGFEGSIAAVVFAPAAELRSVFDNL
IDNALRYAPEGGVVDVKLHQFGGHAVVDVLDNGPGIPKAMMGRVFDRFFRVPGAAAGGSG
LGLAIARTAAERHGLRIELHNRDDGPGLMARVHLPPSPPSPASVSY