Protein Info for GFF3531 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 553 TIGR03719: ATP-binding cassette protein, ChvD family" amino acids 2 to 552 (551 residues), 967.8 bits, see alignment E=1.6e-295 PF00005: ABC_tran" amino acids 22 to 190 (169 residues), 94 bits, see alignment E=2.5e-30 amino acids 339 to 472 (134 residues), 89.7 bits, see alignment E=5.5e-29 PF12848: ABC_tran_Xtn" amino acids 229 to 305 (77 residues), 53.2 bits, see alignment E=5.1e-18

Best Hits

Swiss-Prot: 72% identical to ETTA_HAEIN: Energy-dependent translational throttle protein EttA (ettA) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 86% identity to aaa:Acav_1734)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (553 amino acids)

>GFF3531 ABC transporter (Hydrogenophaga sp. GW460-11-11-14-LB1)
MAQYVFSMNRVGKIVPPKRQILKDISLSFFPGAKIGVLGTNGSGKSTLLKIMAGIDKEIE
GEAIPMPGIRIGYLPQEPQLDPEQNVREAVEASMSGVRAAQKRLDEVYAAYAEEDADFDA
LAAEQAQLEAIIATSGTDGEHQLEIAADALRLPPWDAKIGVLSGGEKRRVALCCLLLSKP
DMLLLDEPTNHLDAESVDWLEQFLQRFPGTVVAITHDRYFLDNAAEWILELDRGHGIPYK
GNYSTWLEQKEARLEQEQRTEDARTKAMKKELEWVRQNPKGRQAKSKARLARFEELSDVE
YQKRNETNEIFIPVAERLGNEVFEFKNVSKSFGDRLLIDNLSFQIPAGAIVGIIGPNGAG
KSTLFKLISGKEQPDSGEVKIGQTVKMAFVDQSREGLDGDKTVWEDISGGLDMITVGKFQ
MPSRAYCGRFNFSGGDQQKRVGSLSGGERGRLHLAKTLAEGGNVLLLDEPSNDLDVETLR
ALEDALLEFAGCALVISHDRWFLDRIATHILAAEGDSQWVFFNGNYQEYEADKKKRLGEE
GAKPKRMRFKALK