Protein Info for GFF3531 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Vitamin B12 ABC transporter, ATPase component BtuD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 PF00005: ABC_tran" amino acids 14 to 158 (145 residues), 80.1 bits, see alignment E=2.5e-26

Best Hits

Swiss-Prot: 100% identical to BTUD_SALDC: Vitamin B12 import ATP-binding protein BtuD (btuD) from Salmonella dublin (strain CT_02021853)

KEGG orthology group: K06074, vitamin B12 transport system ATP-binding protein [EC: 3.6.3.33] (inferred from 99% identity to seg:SG1775)

MetaCyc: 82% identical to vitamin B12 ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-5-RXN [EC: 7.6.2.8]; 7.6.2.8 [EC: 7.6.2.8]

Predicted SEED Role

"Vitamin B12 ABC transporter, ATPase component BtuD" in subsystem Coenzyme B12 biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.33 or 7.6.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (245 amino acids)

>GFF3531 Vitamin B12 ABC transporter, ATPase component BtuD (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MQLKDVAESTRLGPLSGEVSAGEILHLVGPNGAGKSTLLARMAGLTSGEGSIRFGGAPLE
AWATATLAQHRAYLAQQQNPPFAMPVWHYLTLHQPDKTRTGQLNEVADMLGLGDKLGRSV
NQLSGGEWQRVRLAAVVLQIHPDANPVGQLLLLDEPMNSLDVAQQNALDRVLHHLCQAGI
AIVMSSHDLNHTLRHAHKAWLLKRGKLIACGRREEVLTPSYLAQAYGLRFRRLDVEGHPM
LISAT