Protein Info for GFF3530 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 767 transmembrane" amino acids 23 to 47 (25 residues), see Phobius details amino acids 309 to 328 (20 residues), see Phobius details PF02743: dCache_1" amino acids 72 to 292 (221 residues), 54.5 bits, see alignment E=1.9e-18 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 343 to 503 (161 residues), 125.4 bits, see alignment E=9.1e-41 PF00990: GGDEF" amino acids 346 to 499 (154 residues), 151.1 bits, see alignment E=3.6e-48 PF00563: EAL" amino acids 522 to 752 (231 residues), 230 bits, see alignment E=4e-72

Best Hits

KEGG orthology group: None (inferred from 59% identity to xau:Xaut_3139)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (767 amino acids)

>GFF3530 hypothetical protein (Xanthobacter sp. DMC5)
METPNGRETGPQDVAGPALHGPLWLALIAAALIGCVIAATSLLVTNLWDDGTADRARELE
NLAVTLSEQTARAFQSVGLIQDDLITHVRERDIETRAALTDAMSTEDVHSRLREKISGLP
FIDAVTVIDQTGQLLNFSRYWPIPKVNVSDRDYFLALEGMKGPDIFLSEPVPNRGSGTVT
IYLAKRFANSSGRFLGLVLGAMEQSYFERFYGGIRLGHDGMIALIRSDGALLARHPGSAG
VPPRDSAVRARTAAAVFGTGQMTQLPAGTLDEKARIAAVHPVSDLPLAVVVSDSVAALDI
LMWQRATPLIVAAGLLCLTIVLVAWGLGRHLRDERAFAVTQHAMARIDMLTGLPNRLAFA
ERLSALLNARGGATPFALLYLDLDYFKAVNDTLGHDAGDTMLTELAERIRTMLGPDDFSA
RLGGDEFAVVLAGVTHEAEATEFAQRLIEALRTPVHIGLHRIISGCSIGIVMSPRDGAGV
AELLKNADLALYRAKTDGRGIARVFVEEMERLVRERREMEVDLQTAWRERQFFLLYQPIV
EAESGRIAGFEALLRWRHPERGLVNPTSFIPIAEETGLILPLGAWVLTEACAAATAWPDD
LFVSVNLSPIQFRGAEAFRQVRSALESSGLAPSRLEVEITESTLLHEGPMVRATLEQFSE
EGITVALDDFGTGYSSLGYLRTLSIGRIKVDRSFIEQVETSPQSLAIVRAIIGLARTLGL
RCTAEGVETEGQRRLLTAEGCSHLQGYLLGRPGSAEEALRRACASAA