Protein Info for GFF3526 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Lipid A export ATP-binding/permease protein MsbA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 688 transmembrane" amino acids 108 to 130 (23 residues), see Phobius details amino acids 151 to 173 (23 residues), see Phobius details amino acids 225 to 249 (25 residues), see Phobius details amino acids 255 to 274 (20 residues), see Phobius details amino acids 339 to 362 (24 residues), see Phobius details amino acids 368 to 385 (18 residues), see Phobius details PF00664: ABC_membrane" amino acids 113 to 385 (273 residues), 146.5 bits, see alignment E=1.9e-46 PF00005: ABC_tran" amino acids 449 to 597 (149 residues), 116.6 bits, see alignment E=2e-37

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 82% identity to lch:Lcho_4038)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (688 amino acids)

>GFF3526 Lipid A export ATP-binding/permease protein MsbA (Hydrogenophaga sp. GW460-11-11-14-LB1)
MELRLSDHAGVGSLELLDTNGRIAIWRFTMGLQDRAARMVEQFQRLMAQRDQAPDQVVEE
AVRTCPQCQASLPADSDECPECAQEAPQPPPSTWVLLRLWRFARPYRWTLLSGFLLTLAS
TAATLVPPYLTIPLMDRVLIPFQNGQAIDTGLVLALLGGLLGSALLAWSLGWARTWLLAL
VSERISSDLRTTTFDHLLELSLDYFSSKRTGDLMARIGSETDRISVFLSLHALDFLTDVL
MIGMTAVILFSINPWLALATLVPLPFIGWMIHLVRDRLRTGFEKIDRVWGEVTNVLADTI
PGIRVVKAFAQEAREARRFRRANEHNLAVNDRINKTWSLFTPTVTLLTEIGLLVVWAFGI
WLVSQSEITVGVLTAFIAYIGRFYGRLDSMSRIVSVTQKAASGAKRIFDILDHVSNVPEP
TQPVPLTRVQGGLQMENVSFRYGSRTVIRNLSLDIRPGEMIGLVGHSGSGKSTLVNLLCR
FYDVSEGGIRIDGTDIRRVGVADFRRHIGLVLQEPFLFFGTIAENIAYGRPGATRTEIVA
AARAAHAHEFILRLPQGYDSLVGERGQGLSGGERQRISIARALLIDPRILILDEATSSVD
TETEKEIQKALDNLVQGRTTIAIAHRLSTLRKADRLVVMDRGQVVEIGPHDELMAQRGAY
WRLYEAQARKEQEAAALLDADTPEDKDA