Protein Info for GFF3525 in Pseudomonas sp. DMC3

Annotation: L-amino acid N-acetyltransferase AaaT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13302: Acetyltransf_3
  • amino acids 10 to 142 (133 residues), 48.2 bits, E=4.6e-16
• PF13420: Acetyltransf_4
  • amino acids 14 to 160 (147 residues), 37.8 bits, E=4.9e-13
• PF00583: Acetyltransf_1
  • amino acids 39 to 141 (103 residues), 63.1 bits, E=7.7e-21
• PF13673: Acetyltransf_10
  • amino acids 42 to 144 (103 residues), 33 bits, E=1.3e-11
• PF13508: Acetyltransf_7
  • amino acids 59 to 142 (84 residues), 47.2 bits, E=5.9e-16

Best Hits

Swiss-Prot: 40% identical to AAAT_ECOLI: L-amino acid N-acetyltransferase AaaT (aaaT) from Escherichia coli (strain K12)

KEGG orthology group: K03825, putative acetyltransferase [EC: 2.3.1.-] (inferred from 83% identity to pfo:Pfl01_2506)

Predicted SEED Role

"Protein export cytoplasm protein SecA ATPase RNA helicase (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Protein Sequence (172 amino acids)

>GFF3525 L-amino acid N-acetyltransferase AaaT (Pseudomonas sp. DMC3)
MSEPTPTIHLERSNESHLEGITALYNDPAVARQVLQMPFQSIEVWRQRLQADSERALKLV
ALHQGVVIGNLGLEAYSRMRRAHAGSFGMAVAVAWQGKGVGSMLLAAALDVADNWMNLHR
VELTVYADNEAAIGLYRKFGFEAEGLLRDYAVRDGQWVDTLSMARLRGSSKP