Protein Info for GFF3517 in Variovorax sp. SCN45

Annotation: Potassium-transporting ATPase C chain (EC 3.6.3.12) (TC 3.A.3.7.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details PF02669: KdpC" amino acids 10 to 191 (182 residues), 249 bits, see alignment E=1.4e-78 TIGR00681: K+-transporting ATPase, C subunit" amino acids 10 to 192 (183 residues), 221.7 bits, see alignment E=3.9e-70

Best Hits

Swiss-Prot: 78% identical to KDPC_VARPS: Potassium-transporting ATPase KdpC subunit (kdpC) from Variovorax paradoxus (strain S110)

KEGG orthology group: K01548, K+-transporting ATPase ATPase C chain [EC: 3.6.3.12] (inferred from 84% identity to vpe:Varpa_5693)

MetaCyc: 50% identical to K+ transporting P-type ATPase subunit KdpC (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-2 [EC: 7.2.2.6]

Predicted SEED Role

"Potassium-transporting ATPase C chain (EC 3.6.3.12) (TC 3.A.3.7.1)" in subsystem Potassium homeostasis (EC 3.6.3.12, TC 3.A.3.7.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.12

Use Curated BLAST to search for 3.6.3.12 or 7.2.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (203 amino acids)

>GFF3517 Potassium-transporting ATPase C chain (EC 3.6.3.12) (TC 3.A.3.7.1) (Variovorax sp. SCN45)
MNNNSGNIARPALVLFVLLSALTGLIYPMAVTGAAKAVFPAQADGSLIVLDGTTVGSRLI
GQNFSDPKHFWGRPSATSPQPYNGVASGGSNQGPLNPALTDAVKARVEALRAADPGNTAP
VPVDLVTASASGLDPDISPAAARYQAARVARVRGIPLDRINTLIADNTEGPKWGFLGESR
VNVLALNIALDAFAGSFSPSTSR