Protein Info for GFF3508 in Sphingobium sp. HT1-2

Annotation: peptidase A24A, prepilin type IV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06750: A24_N_bact
  • amino acids 12 to 90 (79 residues), 70.6 bits, E=9.7e-24
• PF01478: Peptidase_A24
  • amino acids 105 to 210 (106 residues), 76.3 bits, E=2.3e-25

Best Hits

KEGG orthology group: K02654, leader peptidase (prepilin peptidase) / N-methyltransferase [EC: 2.1.1.- 3.4.23.43] (inferred from 79% identity to sch:Sphch_1269)

Predicted SEED Role

"General secretion pathway protein O"

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 3.4.23.43

Use Curated BLAST to search for 2.1.1.- or 3.4.23.43

Protein Sequence (248 amino acids)

>GFF3508 peptidase A24A, prepilin type IV (Sphingobium sp. HT1-2)
VIDPWATLVGAIAGAIAGSFLATLILRWPQGRGVMRGRSACDGCGRLLGPIDLVPMLSAL
VQRGRCRTCGAAIDPLHGRVEAGCAIIGALALGFVPGLGGIGWALLGWLLLTLAALDWRH
FWLPDALTLPLAFFGFTLGLWTTDVALVDRVIGAAAGYLGLLAIGLGYRALRGREGLGLG
DAKLLGAIGAWLGWQALPFILLIAASLGLAGALVALALGRAVRGQSRVPLGTLLAIATLP
GWIVRGLI