Protein Info for GFF3507 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Cellobiose phosphotransferase system YdjC-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04794: YdjC
  • amino acids 5 to 241 (237 residues), 204.9 bits, E=1.2e-64

Best Hits

Swiss-Prot: 100% identical to CHBG_SALTY: Chitooligosaccharide deacetylase (chbG) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03478, hypothetical protein (inferred from 98% identity to seg:SG1799)

MetaCyc: 76% identical to chitooligosaccharide monodeacetylase ChbG (Escherichia coli K-12 substr. MG1655)
3.5.1.-

Predicted SEED Role

No annotation

MetaCyc Pathways

• chitobiose degradation (2/2 steps found)

Protein Sequence (252 amino acids)

>GFF3507 Cellobiose phosphotransferase system YdjC-like protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MERVLIVNADDFGLSKGQNYGIVEAYRNGVVTSTTALVNGEAIDHAAQLSRELPALGVGM
HFVLTLGKPVSEMPGLTRDGLLGKWIWQMAEEDTLPLDEIAHELACQYQRFIDVFGSEPT
HLDSHHHVHMFPQIFPIVARFAAQRGIALRIDRQTVLNADDLPSDLRSTQGFSSEFYGEE
ITEACFLRILDASAHRGEASLEVMCHPAFVDNIIRQSAYCYPRLTELEVLTSASLKAAIA
ERGYRPGSFLDI