Protein Info for GFF3503 in Variovorax sp. SCN45

Annotation: Subclass B3 beta-lactamase (EC 3.5.2.6)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00753: Lactamase_B" amino acids 101 to 225 (125 residues), 74.1 bits, see alignment E=1.5e-24 PF12706: Lactamase_B_2" amino acids 113 to 245 (133 residues), 30.5 bits, see alignment E=2.6e-11

Best Hits

KEGG orthology group: None (inferred from 81% identity to vpe:Varpa_5704)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (336 amino acids)

>GFF3503 Subclass B3 beta-lactamase (EC 3.5.2.6) (Variovorax sp. SCN45)
MVPSLSLKTAALAAAVALVQGCAQTPAAQKPSDATVAAHVAAATQAAGSDLGPLLSLCKP
APATRPPQEELDKGLPLLINKPAPPPAKAFDNLYFVGADWVSAWAVKTSDGIILIDALNN
QVEAAALIEGGMRKLGLDPAQIKYVIVTHGHGDHYGGAPYLAQKYRARVVMSDLDWRMTE
TKLEFATPIWGAPPKRDISVKDGDRVTLGDTTVTLYLTPGHTMGTLSPVFDVSENGRKHR
AMLWGGTGFNFGKDVPRLDSYIASTKRMDSLVKAQNIDVMLSNHSNVDSSQAKMAALRQQ
PAGAANPFVMGTPTVERALSVMGECAQAQRDRFAMQ