Protein Info for GFF3499 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: NAD synthetase (EC 6.3.1.5)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 TIGR00552: NAD+ synthetase" amino acids 17 to 274 (258 residues), 277.9 bits, see alignment E=3.1e-87 PF02540: NAD_synthase" amino acids 23 to 265 (243 residues), 247.2 bits, see alignment E=6.9e-78

Best Hits

Swiss-Prot: 100% identical to NADE_SALNS: NH(3)-dependent NAD(+) synthetase (nadE) from Salmonella newport (strain SL254)

KEGG orthology group: K01916, NAD+ synthase [EC: 6.3.1.5] (inferred from 99% identity to sty:STY1803)

MetaCyc: 90% identical to NH3-dependent NAD+ synthetase (Escherichia coli K-12 substr. MG1655)
NAD(+) synthase. [EC: 6.3.1.5]

Predicted SEED Role

"NAD synthetase (EC 6.3.1.5)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 6.3.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (275 amino acids)

>GFF3499 NAD synthetase (EC 6.3.1.5) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MTLQQEIIQALGAKPHINPEEEIRRSVDFLKAYLKTYPFLKSLVLGISGGQDSTLAGKLS
QMAIAELREETGDNALQFIAVRLPYGVQADEQDCQDAIAFIQPDRVLTVNIKGAVLASEQ
ALREAGIELSDFVRGNEKARERMKAQYSIAGMTHGVVVGTDHAAEAITGFFTKYGDGGTD
INPLHRLNKRQGKQLLAALGCPEHLYKKVPTADLEDDRPSLPDEAALGVTYDNIDDYLEG
KTLDPAIAKTIEGWYVKTEHKRRLPITVFDDFWKR