Protein Info for GFF3498 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: DNA repair protein RadC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 TIGR00608: DNA repair protein RadC" amino acids 34 to 173 (140 residues), 139.8 bits, see alignment E=5.3e-45 PF04002: RadC" amino acids 53 to 172 (120 residues), 146.6 bits, see alignment E=3.3e-47 PF14464: Prok-JAB" amino acids 57 to 142 (86 residues), 30.1 bits, see alignment E=3.8e-11

Best Hits

KEGG orthology group: K03630, DNA repair protein RadC (inferred from 75% identity to pna:Pnap_4157)

Predicted SEED Role

"DNA repair protein RadC" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (173 amino acids)

>GFF3498 DNA repair protein RadC (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSQLSSLSFTSSTDSSLLVRDVAGSYRPAEPAEVLQAALRVLAGQLRGSEMLSSPQAVRD
FLRIQLGTLEHEVFAVIHLDAQHRVIEYVEMFRGTVTQTSVYPREVVKEAMAHNTAAIVL
IHNHPSGVAEPSRADEHLTQTLKSALSLVDVRVIDHLIVAGPTILSFAERGLI